PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009608882.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 304aa    MW: 33412.9 Da    PI: 10.0223
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009608882.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA88.59.6e-28136190258
       CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      p++VNaKQy++Il+RR++Rak  e kk   k rkpylh SRh hA+rRpRg+gGrF
  XP_009608882.1 136 GPIFVNAKQYHGILRRRKSRAKEME-KKA-LKPRKPYLHLSRHLHAMRRPRGCGGRF 190
                     69*******************9666.555.6*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-30133193IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115231.964134193IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.1E-23137190IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.7E-21137159IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.7E-21167190IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MTIMHTLFSS KGNEGIVQNP VATLSTTVPW WSSGLVSQSS SAEHSELPKG NATEFTIFSV  60
SPSGDWKSSG YGQNQSNIQA VANMDYRGQF ELGFGQSLIS AKYPYGGEQS VGLFSAYGPQ  120
LSGRVMLPLN LASDEGPIFV NAKQYHGILR RRKSRAKEME KKALKPRKPY LHLSRHLHAM  180
RRPRGCGGRF LNTRKMNGTM KGGKTTDTVK TGDVYSFYPI GSQNSEVLQS DSSNLSSPKE  240
TTGSRLCHSS EVTNMYCRRN LDPFPFQDLR PSVQPIPDMM NTGHGILMAG KWVSAADSCC  300
NLKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A2e-16135191260HAPB protein
4g92_A2e-16135191260HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4897581e-171AM489758.1 Petunia x hybrida partial mRNA for YA1 (nf-YA gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608882.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X3
TrEMBLM1BXA51e-164M1BXA5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000550611e-164(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.18e-41nuclear factor Y, subunit A2